PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613545.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 261aa    MW: 30020.2 Da    PI: 10.3489
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613545.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161762147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l ++v+ +G++ W+ Iar+m+ gRt+k+c++rw++ 
   XP_013613545.1 17 RGHWKPSEDFKLQELVTVFGPKKWNHIARKMQ-GRTGKSCRLRWFNQ 62
                     899*****************************.***********996 PP

2Myb_DNA-binding52.31.3e-1669111145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + ++++eE+e+l+ +++ +G++ W++Ia+ ++ gRt++ +k++w+
   XP_013613545.1  69 KSAFSEEEEEKLLAVHRTFGNK-WSLIAKLFP-GRTDNAVKNHWH 111
                      578*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9991263IPR017930Myb domain
SMARTSM007171.9E-121665IPR001005SANT/Myb domain
SuperFamilySSF466894.79E-2817110IPR009057Homeodomain-like
PfamPF002492.2E-141762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-241870IPR009057Homeodomain-like
CDDcd001675.14E-112061No hitNo description
PROSITE profilePS5129425.66564118IPR017930Myb domain
SMARTSM007176.1E-1468116IPR001005SANT/Myb domain
PfamPF002491.1E-1469111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2171118IPR009057Homeodomain-like
CDDcd001675.30E-1171111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MMHQENKKKH LSKVCTRGHW KPSEDFKLQE LVTVFGPKKW NHIARKMQGR TGKSCRLRWF  60
NQLDPRILKS AFSEEEEEKL LAVHRTFGNK WSLIAKLFPG RTDNAVKNHW HILMARKLRK  120
QSISYSKSRK RQTPSPDEIT PLNLLPSFNL FPGSVGDEST EFNNYSWKMP KEESANLRDQ  180
FLLEEYCSMR MSMQYLGHHH HQHGFSTLPA DSVELLTRYL SNSQPSSSSS PPTSALSTSG  240
AENTMTTKPP RFIDFLGVGA S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-321611826128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613545.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A078GYN31e-176A0A078GYN3_BRANA; BnaC04g31750D protein
STRINGBra025652.1-P1e-167(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.24e-84myb domain protein 110